Bombus vancouverensis nearcticus: 117162695 Help Entry 117162695         CDS       T07628                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism bvan  Bombus vancouverensis nearcticus Pathway bvan04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bvan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117162695  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bvan04121]     117162695    03400 DNA repair and recombination proteins [BR:bvan03400]     117162695 Ubiquitin system [BR:bvan04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      117162695    Cul5 complex      117162695 DNA repair and recombination proteins [BR:bvan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117162695 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  117162695 NCBI-ProteinID:  XP_033200430 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKIPPVNQQLFNKDNVPMSDSKFLSD YGLTSSTAKPQCPALVGLAVRQENGQFEALEMTPFSLPPDLPDVMKSQEANGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctaatgatccgacgaaaaaatatgaccatatttaccgatgccaaggat aataccacagttcttgaacttaaaaaaattatagaaggtatattgaaaataccacctgtg aatcaacagctgttcaataaggacaatgttccaatgtcagatagtaaatttttatctgat tatggactaacatcatcaactgcaaaaccacaatgtcctgcattagtaggattagctgtg cgtcaagaaaatggtcaatttgaagcattagagatgacaccattttcattaccacctgat ttaccagatgttatgaaatctcaagaagccaatggacaagaacagtcaccttga

DBGET integrated database retrieval system