Brevundimonas vesicularis: CEP68_15205 Help Entry CEP68_15205       CDS       T04934                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bvc  Brevundimonas vesicularis Pathway bvc01100   Metabolic pathways bvc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bvc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CEP68_15205    00074 Mycolic acid biosynthesis     CEP68_15205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CEP68_15205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ASE40724 UniProt:  A0A1Z3UCM2 LinkDB All DBs Position 3006888..3007127 Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFIDEKSAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaccctcgagcgcgttcgcaagatcgtcatcgaccatctggacgccgatccg gacaaggtcaccgaaaaggccagcttcatcgacgacctgggcgctgactcgctcgacaac gtcgagctggtgatggccttcgaagaagaattcgacatcgagatcccggatgacgccgcc gagcacattcagacggtcggcgatgcggtcaagttcatcgacgaaaagtcggccggctga

DBGET integrated database retrieval system