Burkholderia vietnamiensis LMG 10929: AK36_558 Help Entry AK36_558          CDS       T03893                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bve  Burkholderia vietnamiensis LMG 10929 Brite KEGG Orthology (KO) [BR:bve00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bve03036]     AK36_558    03400 DNA repair and recombination proteins [BR:bve03400]     AK36_558 Chromosome and associated proteins [BR:bve03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     AK36_558 DNA repair and recombination proteins [BR:bve03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       AK36_558 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE Motif Other DBs NCBI-ProteinID:  AJY06885 LinkDB All DBs Position I:complement(590644..590937) Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLAELGLSRAKAGKVGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNRDQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctcgcccagcgggagaagctggagaagcaaatcgaagaa gcaaagtcgcgtgaatacgcggaagtgctgaatgacgtgaagcagaaaattgccgactac ggcttttcgctcgccgaactcggtctcagccgtgcgaaggcgggcaaggtcggccgtccg cgcgccggtgtggcagcaaagtaccgtgacccggaatcgggcgcgacgtggtcgggccgc ggcaagccgccgcgctggatcgccggcaagaaccgcgatcagttcgcgatttaa

DBGET integrated database retrieval system