Bosea vestrisii: QO058_07115
Help
Entry
QO058_07115 CDS
T09164
Name
(GenBank) response regulator
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
bves
Bosea vestrisii
Pathway
bves02020
Two-component system
bves02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
bves00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
QO058_07115
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
QO058_07115
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
bves02022
]
QO058_07115
02035 Bacterial motility proteins [BR:
bves02035
]
QO058_07115
Two-component system [BR:
bves02022
]
CheA family
CheA-CheYBV (chemotaxis)
QO058_07115
Bacterial motility proteins [BR:
bves02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
QO058_07115
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Receiver_CRE1
Motif
Other DBs
NCBI-ProteinID:
WID98007
LinkDB
All DBs
Position
1437117..1437482
Genome browser
AA seq
121 aa
AA seq
DB search
MKYCLVVDDSAVIRKVARRILEGLQFRIAEAEDGARAIDACKGEMPDAILLDWNMPVMDG
YDFLRNLRQMPGGKRPKVVFCTTENDIAHIARAMHAGADEYIMKPFDKEIVASKFHQVGL
L
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
atgaaatactgcctcgtcgtcgatgactccgccgtcatccgcaaggttgcccgccgcatc
ctggaagggctgcagttccgcatcgccgaagccgaggacggcgcgcgcgcgatcgacgcc
tgcaagggcgagatgccggacgccatcctgctcgactggaacatgccggtcatggacggc
tacgacttcctgcggaatctccggcagatgcctggcggcaaacggcccaaggtcgtgttc
tgcaccaccgagaacgacatcgcccacatcgcccgcgccatgcatgcaggcgccgacgag
tacatcatgaagccgttcgacaaggagatcgtggcctcgaaattccatcaggtcggcctg
ctctaa
DBGET
integrated database retrieval system