Beta vulgaris (sugar beet): 104906637 Help Entry 104906637         CDS       T03548                                  Name (RefSeq) hypothetical protein   KO K03873   elongin-B Organism bvg  Beta vulgaris (sugar beet) Pathway bvg04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bvg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104906637  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bvg04121]     104906637    03400 DNA repair and recombination proteins [BR:bvg03400]     104906637 Ubiquitin system [BR:bvg04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      104906637    Cul5 complex      104906637 DNA repair and recombination proteins [BR:bvg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      104906637 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD UBL_UBAC1 Dsc3_N Ubiquitin_2 GABP-alpha DUF2604 Rad60-SLD_2 Motif Other DBs NCBI-GeneID:  104906637 NCBI-ProteinID:  XP_010693721 UniProt:  A0A0J8BFX3 LinkDB All DBs Position 3 Genome browser AA seq 104 aa AA seqDB search MAMYIRVKRSKTTYFIQCDPTEKILELKQKLHSLIDEPVDHQRLILVETGEVLEDSKTLA DQKVENDAVVALTLKKDDNEFEDVNIVKPTDFYQSRDSDGGSNW NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggccatgtatattcgtgttaagcgtagcaagacaacctacttcattcagtgtgatcct actgaaaaaattctggagttaaagcagaagttgcatagtcttattgacgaacctgttgat caccagcggttgattctcgtagaaactggggaagtgttagaggattccaagactttggca gaccagaaggtggagaatgatgctgtggtggcattgaccttgaaaaaagatgataatgaa tttgaagatgtcaacatcgtaaagccaactgatttctatcaatctcgggattcagatggc ggttccaattggtaa

DBGET integrated database retrieval system