Burkholderia vietnamiensis G4: Bcep1808_1043 Help Entry Bcep1808_1043     CDS       T00493                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bvi  Burkholderia vietnamiensis G4 Pathway bvi00998   Biosynthesis of various antibiotics bvi01100   Metabolic pathways bvi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bvi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bcep1808_1043    00074 Mycolic acid biosynthesis     Bcep1808_1043   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bcep1808_1043 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ABO54054 UniProt:  A4JCQ1 LinkDB All DBs Position 1:1128459..1128698 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataacatcgaacaacgtgtcaagaagatcgtcgctgagcaactgggcgtcgcggaa gccgagatcaagaacgaagcatcgttcgtgaacgatctgggtgcagactcgctcgacacg gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgacggttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system