Brevundimonas vitisensis: JIP62_03920 Help Entry JIP62_03920       CDS       T07812                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bvit  Brevundimonas vitisensis Pathway bvit01100   Metabolic pathways bvit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bvit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JIP62_03920    00074 Mycolic acid biosynthesis     JIP62_03920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JIP62_03920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QQQ19271 UniProt:  A0ABX7BNZ3 LinkDB All DBs Position complement(778154..778393) Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIEHLDADPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFIDEKLAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaccctggaacgcgttcgcaagatcgtcatcgaacatctggacgccgacccc gagaaggtgaccgaaaaggccagcttcattgacgatctgggcgctgactcgctcgacaac gtcgagctggtcatggccttcgaagaagaattcgacatcgaaatcccggacgacgccgcc gagcacatccagacggtcggcgacgccgtgaagttcatcgacgagaagctggcgggctaa

DBGET integrated database retrieval system