Heyndrickxia vini: I5776_04810 Help Entry I5776_04810       CDS       T07201                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bvj  Heyndrickxia vini Pathway bvj01100   Metabolic pathways bvj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bvj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I5776_04810    00074 Mycolic acid biosynthesis     I5776_04810   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I5776_04810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QQZ11418 LinkDB All DBs Position 964946..965173 Genome browser AA seq 75 aa AA seqDB search MKERLLFIINEMLEENDQERIKSWDESIKLRDDLNMDSLMLAELTVRIEDEFDIDIFEDG IVQTINEILLKIEGK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt ataaaagaaagattattatttattattaacgagatgctggaggaaaatgaccaagaacgt ataaaaagttgggatgagtcaattaaattaagggatgatttaaatatggattcccttatg ctcgcagaactaacggttagaattgaggatgaatttgatattgacatatttgaggatgga attgtgcaaactattaatgaaattcttttaaaaatagaaggaaaataa

DBGET integrated database retrieval system