Brucella vulpis: BF3285c1_1352 Help Entry BF3285c1_1352     CDS       T04257                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bvl  Brucella vulpis Pathway bvl01100   Metabolic pathways bvl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bvl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BF3285c1_1352 (acpP)    00074 Mycolic acid biosynthesis     BF3285c1_1352 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BF3285c1_1352 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  CUW44030 LinkDB All DBs Position 1:1343958..1344194 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system