Brucella vulpis: BF3285c2_0061 Help Entry BF3285c2_0061     CDS       T04257                                  Symbol ybgT Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bvl  Brucella vulpis Pathway bvl00190   Oxidative phosphorylation bvl01100   Metabolic pathways bvl02020   Two-component system Module bvl_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bvl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BF3285c2_0061 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BF3285c2_0061 (ybgT) Enzymes [BR:bvl01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BF3285c2_0061 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  CUW44947 LinkDB All DBs Position 2:59795..59950 Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcctggcttttgggcctgccgcttgcagccgcgttcgctgtgctgaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcatcactga

DBGET integrated database retrieval system