Bremerella volcania: Pan97_14810 Help Entry Pan97_14810       CDS       T06456                                  Name (GenBank) Anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism bvo  Bremerella volcania Pathway bvo02020   Two-component system bvo02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:bvo00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Pan97_14810  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Pan97_14810  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:bvo02035]     Pan97_14810 Bacterial motility proteins [BR:bvo02035]  Flagellar system   Flagellar assembly proteins    Others     Pan97_14810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QDU74473 UniProt:  A0A518C5G9 LinkDB All DBs Position 1757123..1757401 Genome browser AA seq 92 aa AA seqDB search MHVNGPTAVHPAQSIRGPHHAPQAPAVDSRTQFDTVDELDISHEADFASQVKDIPDIRAD RVAQIKAQIADGTYMTDDKLDLALERLLDEIG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcatgttaatggcccaaccgcagttcacccggcacagtccatccgaggtccgcatcac gcaccgcaggccccggccgtcgacagccgcacccaattcgataccgtggatgaacttgat atttcgcacgaagccgatttcgccagccaggtgaaggacattccggacattcgcgccgat cgagtcgcccagatcaaagctcaaatcgctgatggcacctacatgaccgacgacaagctc gatctggccctggaacgtctcttggatgaaattggctaa

DBGET integrated database retrieval system