Blastochloris viridis: BVIR_1044 Help Entry BVIR_1044         CDS       T04109                                  Name (GenBank) DNA-binding protein HRL53   KO K03530   DNA-binding protein HU-beta Organism bvr  Blastochloris viridis Brite KEGG Orthology (KO) [BR:bvr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bvr03032]     BVIR_1044    03036 Chromosome and associated proteins [BR:bvr03036]     BVIR_1044    03400 DNA repair and recombination proteins [BR:bvr03400]     BVIR_1044 DNA replication proteins [BR:bvr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BVIR_1044 Chromosome and associated proteins [BR:bvr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BVIR_1044 DNA repair and recombination proteins [BR:bvr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BVIR_1044 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  ALK08834 UniProt:  A0A0H5BC66 LinkDB All DBs Position 1147766..1148041 Genome browser AA seq 91 aa AA seqDB search MTKNELVAAVADRLDSTKTAAAAAVEATFDVIAAALKKGDDVKLIGFGSFSVVKRAAREG RNPRTGKPVKIKASKAPKFTPGKALKQMVNR NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccaagaatgaattggtcgctgccgttgcggatcgtctcgactccaccaagacggct gcggccgctgcggtggaggcgaccttcgacgtcattgcggcagcgctcaagaaaggcgac gacgtcaagctgatcggctttggctcgttctcggtggtcaagcgcgccgcgcgcgagggc cgcaacccgcgcaccggcaagccggtgaagatcaaggcgtcgaaggcgccgaagttcacg cccggcaaggcgctcaagcagatggtcaatcgctga

DBGET integrated database retrieval system