KEGG   Blastochloris viridis: BVIR_1460
Entry
BVIR_1460         CDS       T04109                                 
Name
(GenBank) ATP-dependent Clp protease adapter protein ClpS
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
bvr  Blastochloris viridis
Brite
KEGG Orthology (KO) [BR:bvr00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BVIR_1460
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-ProteinID: ALK09243
UniProt: A0A0P0J6U3
LinkDB
Position
1596841..1597260
AA seq 139 aa
MSNQSVAGLPMILEFPLTKSRDAAPGRPRAMADKGKPVTPAGPGTAVIARTKAQTKRPSL
YRVLLLNDDYTPMEFVVLILERFFGKNRDEATRIMLHVHHHGVGECGIYTYEVAETKVTQ
VMDFARKHQHPLQCVMEKK
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtcgaaccaaagcgttgccggcttgccgatgatcctggagtttcctctgaccaaatcg
cgagatgccgcgccggggcgtccccgcgcaatggccgacaagggcaaaccggtcacgccg
gccgggccggggacggcggtgatcgcgcgaaccaaggcgcagaccaagcgcccgagtttg
taccgcgtgctgctgctgaacgacgattacacgccgatggaattcgtcgttttgatcctg
gagcggttctttggaaagaaccgtgacgaagcgacgcgcattatgttgcatgtccaccac
catggcgtcggcgagtgcgggatctatacctatgaggtggcggaaacaaaagtcacgcag
gtgatggacttcgcccgcaaacaccagcaccctctccagtgcgttatggagaagaaatag

DBGET integrated database retrieval system