Blastochloris viridis: BVIR_294 Help Entry BVIR_294          CDS       T04109                                  Name (GenBank) Glutaredoxin-3   KO K03676   glutaredoxin 3 Organism bvr  Blastochloris viridis Brite KEGG Orthology (KO) [BR:bvr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bvr03110]     BVIR_294 Chaperones and folding catalysts [BR:bvr03110]  Protein folding catalysts   Protein disulfide isomerase    BVIR_294 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 SH3BGR Thioredoxin_2 GST_N_2 Thioredoxin_3 TraF Motif Other DBs NCBI-ProteinID:  ALK08109 UniProt:  A0A0H5B8T4 LinkDB All DBs Position 312003..312260 Genome browser AA seq 85 aa AA seqDB search MPPIVLYSKSSCPYCHAAKELLRRKGATFTEIDISGDASARAEMLARSGGVSTVPQIFIG TTHVGGCDDLYALEEKGQLDPLLVA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcccccgatcgtgctctattcgaaatcgtcctgcccctattgccacgccgccaaggag ctgctgcgacgcaagggcgctaccttcaccgagatcgacatttccggcgatgcctccgcg cgcgccgagatgctggcgcgctcgggcggcgtctcgaccgtgccgcagatcttcatcggc accacccacgtcggcggctgcgacgacctctacgcgctggaggaaaagggccagctcgat ccgctgctggtggcctga

DBGET integrated database retrieval system