Brevundimonas vancanneytii: NCTC9239_01134 Help Entry NCTC9239_01134    CDS       T06708                                  Symbol acpP Name (GenBank) Acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism bvy  Brevundimonas vancanneytii Pathway bvy01100   Metabolic pathways bvy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bvy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC9239_01134 (acpP)    00074 Mycolic acid biosynthesis     NCTC9239_01134 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC9239_01134 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 DUF7080 Motif Other DBs NCBI-ProteinID:  VTO13676 UniProt:  A0A4P1K2S2 LinkDB All DBs Position 1:1131019..1131258 Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFDVEIPDDAA EHIQTVGDAVKFIDEKLAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaccctcgaacgcgtccgcaagatcgtgatcgaccacctggacgccgatccg gacaaggtcaccgagaaggcttccttcatcgacgacctgggcgccgactcgctcgacaac gtcgaactggtcatggccttcgaagaagaattcgacgtcgaaatcccggatgacgccgcc gagcacatccagaccgtcggcgacgcggtgaagttcatcgacgagaagctggccgcctga

DBGET integrated database retrieval system