Brevundimonas vancanneytii: NCTC9239_02827 Help Entry NCTC9239_02827    CDS       T06708                                  Symbol phbA_3 Name (GenBank) Acetyl-CoA acetyltransferase   KO K00626   acetyl-CoA C-acetyltransferase [EC:2.3.1.9] Organism bvy  Brevundimonas vancanneytii Pathway bvy00071   Fatty acid degradation bvy00280   Valine, leucine and isoleucine degradation bvy00310   Lysine degradation bvy00362   Benzoate degradation bvy00380   Tryptophan metabolism bvy00620   Pyruvate metabolism bvy00630   Glyoxylate and dicarboxylate metabolism bvy00650   Butanoate metabolism bvy00720   Other carbon fixation pathways bvy00900   Terpenoid backbone biosynthesis bvy01100   Metabolic pathways bvy01110   Biosynthesis of secondary metabolites bvy01120   Microbial metabolism in diverse environments bvy01200   Carbon metabolism bvy01212   Fatty acid metabolism bvy02020   Two-component system Brite KEGG Orthology (KO) [BR:bvy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00620 Pyruvate metabolism     NCTC9239_02827 (phbA_3)    00630 Glyoxylate and dicarboxylate metabolism     NCTC9239_02827 (phbA_3)    00650 Butanoate metabolism     NCTC9239_02827 (phbA_3)   09102 Energy metabolism    00720 Other carbon fixation pathways     NCTC9239_02827 (phbA_3)   09103 Lipid metabolism    00071 Fatty acid degradation     NCTC9239_02827 (phbA_3)   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     NCTC9239_02827 (phbA_3)    00310 Lysine degradation     NCTC9239_02827 (phbA_3)    00380 Tryptophan metabolism     NCTC9239_02827 (phbA_3)   09109 Metabolism of terpenoids and polyketides    00900 Terpenoid backbone biosynthesis     NCTC9239_02827 (phbA_3)   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     NCTC9239_02827 (phbA_3)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     NCTC9239_02827 (phbA_3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bvy04147]     NCTC9239_02827 (phbA_3) Enzymes [BR:bvy01000]  2. Transferases   2.3  Acyltransferases    2.3.1  Transferring groups other than aminoacyl groups     2.3.1.9  acetyl-CoA C-acetyltransferase      NCTC9239_02827 (phbA_3) Exosome [BR:bvy04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    NCTC9239_02827 (phbA_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thiolase_C Thiolase_C_1 ACP_syn_III_C Motif Other DBs NCBI-ProteinID:  VTO18599 UniProt:  A0A4P1KGL4 LinkDB All DBs Position 1:complement(2736892..2737170) Genome browser AA seq 92 aa AA seqDB search MEKAGWTVADLDLIESNEAFAAQSLCVVKELGLDPAKVNVNGGAIAIGHPVGASGARVLT TLLHEMKRSGAKKGLATLCIGGGMGVAMCVER NT seq 279 nt NT seq  +upstreamnt  +downstreamnt ttggagaaggcgggctggaccgtcgccgatctggacctgatcgaatccaacgaggccttc gccgcccagtcgctgtgcgtggtcaaggagctgggtctcgacccggccaaggtgaacgtc aacggcggcgccatcgccatcggccacccggtcggcgcttcgggcgcgcgcgtcctgacg acgctgctgcacgagatgaagcgctcgggcgcgaagaagggcctggcgaccctgtgcatc ggcggcggcatgggcgtggcgatgtgcgtcgagcgctaa

DBGET integrated database retrieval system