Bradyrhizobium vignae: BRAD3257_7092 Help Entry BRAD3257_7092     CDS       T06968                                  Name (GenBank) protein of unknown function   KO K04078   chaperonin GroES Organism bvz  Bradyrhizobium vignae Brite KEGG Orthology (KO) [BR:bvz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bvz03110]     BRAD3257_7092    03029 Mitochondrial biogenesis [BR:bvz03029]     BRAD3257_7092 Chaperones and folding catalysts [BR:bvz03110]  Heat shock proteins   HSP10    BRAD3257_7092 Mitochondrial biogenesis [BR:bvz03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     BRAD3257_7092 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  SPP97922 UniProt:  A0A2U3Q948 LinkDB All DBs Position BRAD3257:6566879..6567046 Genome browser AA seq 55 aa AA seqDB search MKFRPLHDRVGKRIDANEKTACGVIIPDTAKQKLQAWIVQLIFGLTLATTWLVTM NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgaaattccgtccgcttcacgaccgcgtcggcaagcgcatcgacgccaacgagaagacc gcttgcggcgttatcattcccgacacagccaagcaaaagctgcaggcatggatcgttcag ctcatttttggcttgacccttgctacaacttggcttgtcacaatgtga

DBGET integrated database retrieval system