Bacillus wiedmannii: CT694_31285 Help Entry CT694_31285       CDS       T05831                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bwd  Bacillus wiedmannii Brite KEGG Orthology (KO) [BR:bwd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bwd03032]     CT694_31285    03036 Chromosome and associated proteins [BR:bwd03036]     CT694_31285    03400 DNA repair and recombination proteins [BR:bwd03400]     CT694_31285 DNA replication proteins [BR:bwd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CT694_31285 Chromosome and associated proteins [BR:bwd03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CT694_31285 DNA repair and recombination proteins [BR:bwd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CT694_31285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 HU-CCDC81_bac_2 DUF2267 NTPase_1 Motif Other DBs NCBI-ProteinID:  AZJ24010 LinkDB All DBs Position pFCC41-1-490K:complement(366008..366280) Genome browser AA seq 90 aa AA seqDB search MNKTELTKVVAEKAELTQKDAAAATQALLDTITNALANEEKVQILGFGTFEVRERSARTG RNPQTGEEMQIAASKAPAFKAGKELKEAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacagaattaacaaaagtagtagcagaaaaagctgaacttacacaaaaagat gctgctgcagcaacacaagcgttattagatacaataacaaatgcgttagcaaatgaagag aaagtacagattcttggttttggtacatttgaagtacgtgaaagatctgcacgtacagga cgtaacccacaaacaggtgaagaaatgcaaatcgcggcttcaaaagcacctgcttttaag gctggaaaagaattaaaagaagcagtgaaataa

DBGET integrated database retrieval system