Bacillus mycoides KBAB4: BcerKBAB4_1847 Help Entry BcerKBAB4_1847    CDS       T00642                                  Name (GenBank) putative acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism bwe  Bacillus mycoides KBAB4 Brite KEGG Orthology (KO) [BR:bwe00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01053 Biosynthesis of siderophore group nonribosomal peptides     BcerKBAB4_1847  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bwe01008]     BcerKBAB4_1847 Polyketide biosynthesis proteins [BR:bwe01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     BcerKBAB4_1847 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABY43079 UniProt:  A9VRP4 LinkDB All DBs Position 1918689..1918964 Genome browser AA seq 91 aa AA seqDB search MSREMLKEAVLSIMREKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDLKLCVPE DEIDPKAFLTVGSLLDFMEELQPLHEINVNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagtcgtgaaatgttaaaagaagcagttttaagtattatgagagaaaaaatggaactg aaaaatgtaacgcatttagaagaaacgatgcgtttaaatcaagatttatatatagattcg gtaatgatgttacagcttatagtatacatagaaatggatttaaagctatgcgttccagag gatgagatagacccaaaggcgtttcttactgtaggatctttgcttgactttatggaagag ttacagccgttacacgaaataaatgtgaataactaa

DBGET integrated database retrieval system