Bacillus mycoides KBAB4: BcerKBAB4_3673 Help Entry BcerKBAB4_3673    CDS       T00642                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bwe  Bacillus mycoides KBAB4 Pathway bwe01100   Metabolic pathways bwe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bwe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BcerKBAB4_3673    00074 Mycolic acid biosynthesis     BcerKBAB4_3673   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BcerKBAB4_3673 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  ABY44844 UniProt:  A9VT88 LinkDB All DBs Position complement(3724744..3724977) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIVVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISDEDA EKIATVGDAVTYIESHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttttagagcgtgtaaccaaaattgtcgttgatcgtttaggagtagaagaa actgaagtagtaccagctgcaagcttcaaagaagatttaggcgcagactccctagatgta gtagaacttgtaatgcaattagaagatgaattcgaaatggaaatttctgatgaagatgct gaaaagattgctactgttggcgatgctgtgacttacatagagagtcatctataa

DBGET integrated database retrieval system