KEGG   Brachymonas wangyanguii: ACI3EV_00060
Entry
ACI3EV_00060      CDS       T11206                                 
Name
(GenBank) GlsB/YeaQ/YmgE family stress response membrane protein
Organism
bwn  Brachymonas wangyanguii
SSDB
Motif
Pfam: Transgly_assoc
Other DBs
NCBI-ProteinID: XKQ52895
LinkDB
Position
complement(13665..13907)
AA seq 80 aa
MSILYWLIIGLIAGWLAGLIMKGSGYGVLANIGLGIVGALLGGFLFGLLGLGATGAIGSI
VTATVGAVVVIFLARMLRRA
NT seq 243 nt   +upstreamnt  +downstreamnt
atgtcgattctgtactggctcatcatcggcctgattgccggctggctggccggcctcatc
atgaaaggcagcggctacggcgtgctggccaatatcgggctcggcattgttggtgccttg
ctcggcggtttcctgttcggcctgctggggctgggcgctacgggtgccatcggcagcatc
gtcaccgccacagtgggtgcggtcgtggtgattttcctggcacggatgttgcgccgcgcc
tga

DBGET integrated database retrieval system