Brachymonas wangyanguii: ACI3EV_10415
Help
Entry
ACI3EV_10415 CDS
T11206
Name
(GenBank) AAA family ATPase
KO
K07028
uncharacterized protein
Organism
bwn Brachymonas wangyanguii
Brite
KEGG Orthology (KO) [BR:
bwn00001
]
09190 Not Included in Pathway or Brite
09194 Poorly characterized
99997 Function unknown
ACI3EV_10415
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AAA_33
Zeta_toxin
AAA_18
AAA_17
KTI12
Motif
Other DBs
NCBI-ProteinID:
XKQ52670
LinkDB
All DBs
Position
complement(2164792..2166357)
Genome browser
AA seq
521 aa
AA seq
DB search
MSATDSTSAPPVRRMIPEMDLATAQQMVEQLQQQLQARHPGAPVQCRQTHISWVLLAGDK
AYKLRKPLNLGFLDYSTRALRRHGSEEELRLNRRTAPELYEALVPITGTPQQPVWGGDGE
AIDYAVQMRRFEQDGLLAVLAARGELQPEQLDALALQVAQMHAVAEVSAPGAPHGDPMGI
CHAAADNFGTLRGRLHSADERAMLQRLLRWTRAESARLAPLFQQRWQQGWIRECHGDLHL
GNLVLLQGKPVPFDAIEFSPAFRWVDVMADLAFLVMDLLHRDRPDLAWRVLNTWLEQTGD
YAGLETLRYFLVYRALVRAKVAALQGLPEATAYLQLADRLSQPSQPRLWIMHGLSGSGKS
YQAQALSAHTGAIRIRADVERKRLFGLAPLASSHGQADIYTAEASEQTYARLGQLAQQVL
QAGYPVVLDATFMQQQHRAPMQQLAARLGVPFQILSLQATPELLRERVQQRQQQGQDASE
ADLAVLESQLAHVQPLAAEELPQALLLDVSQPVDWPRLLAE
NT seq
1566 nt
NT seq
+upstream
nt +downstream
nt
atgtctgccaccgattccacctctgcacctcccgtccgccgcatgatccccgaaatggat
ctggccactgctcagcagatggtggaacagctgcagcagcagttgcaggcacggcatccc
ggtgcgccggtgcaatgccggcagacgcatatttcctgggtgctgctggctggcgacaag
gcctacaagctgcgcaagccgctgaacctgggctttctggactacagcacgcgggcgctg
cgccgccacggcagcgaggaagagctgcgcctgaaccgccgcactgcgcccgagctgtac
gaggcgctggtgccgattaccggcacgccgcaacaaccggtctggggcggtgacggcgaa
gcgatcgattacgcggtgcaaatgcgccgttttgaacaggacggcctgctggctgtactg
gccgcgcgtggcgagctgcagccggaacaactggatgcgctggcgctgcaggtggcgcag
atgcatgccgtggccgaggtctccgcgccgggggcgccgcatggcgatcccatgggcatc
tgccatgcggcagccgacaactttggcaccctgcgtggccgcctgcacagcgcggacgag
cgcgccatgctgcagcgcctgctgcgctggacgcgtgccgaaagcgcgcggctggcaccg
ctgttccagcagcgctggcagcagggctggatccgcgagtgccatggcgacctgcatctg
ggcaatctggtgttgctgcagggcaagccggtaccatttgatgcgatcgagttttcgccg
gccttccgctgggtggacgtgatggccgacctggccttcctggtgatggacctgctgcac
cgggatcgacccgatctggcctggcgcgtgctcaatacctggctggagcagaccggcgac
tatgccgggctggagacgctgcgctatttcctcgtgtaccgggcgctggtgcgtgccaag
gtggcggcgctgcaaggcctgccggaggccacggcctacctgcaactggccgatcgcctg
agccagccgagccagccgcggctgtggatcatgcatggcctgtcgggatcgggcaagagc
taccaggcgcaggcgctgtcggcgcataccggcgcgatccgcatccgagccgatgtcgag
cgcaagcgcctgttcggcctggcaccgctggccagcagccatggccaggcggacatctat
accgccgaggcctcggagcagacctatgcccgactggggcagctggcacagcaggtgctg
caggctggctacccggtggtgctcgatgccaccttcatgcagcaacagcaccgcgcgccc
atgcagcagttggcggcgcggctgggtgtgccgttccagatcctgagcctgcaggccacg
ccggagctgttgcgcgagcgtgtgcagcaacgtcagcagcaggggcaggacgcctccgaa
gccgatctggcggtgctggagagccagctggcgcatgtccagccgctggcggccgaagag
ctgccgcaggcgctgttgctcgatgtgtcgcagccggtggattggccgcgcctgctggcg
gagtga
DBGET
integrated database retrieval system