KEGG   Paraburkholderia xenovorans LB400: DR64_1262
Entry
DR64_1262         CDS       T03290                                 
Name
(GenBank) short chain dehydrogenase family protein
  KO
K10617  p-cumic alcohol dehydrogenase
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00622  Xylene degradation
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
bxb01220  Degradation of aromatic compounds
Module
bxb_M00419  Cymene degradation, p-cymene => p-cumate
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    DR64_1262
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DFP
Other DBs
NCBI-ProteinID: AIP30111
UniProt: Q143R4
LinkDB
Position
1:complement(1348519..1349277)
AA seq 252 aa
MRLEGKVAIITGAATGIGNAIARAYVAEGAKVVIADLKGAEAAASELGAGIALGIYANVA
DPDSTRQMAAAAVERFGKIDVLVNNAGIFTGLSGVPMEGITVEDWDKLYAVNVKGPWLCT
SAVSAAMREGGGGKIINIASVIAHVGVPFMLHYVSSKGAVAAMTRAMAREFAATKAGITV
NAISPGYTHSANAVANTQQHEQFEGVAAQMRTIGRPQVPEDIAGAALWLASDEASYVNGQ
NIIVDGGIFMSL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagacttgaaggcaaggtggcgatcatcaccggtgcggcaaccggtatcggcaacgcg
atcgcgcgggcgtatgtggccgaaggtgcgaaggtcgtgattgcagacctgaagggggcg
gaggcagcggcatctgaacttggcgcgggtattgcgctaggtatttacgccaacgtcgcc
gatccggacagcaccaggcagatggctgctgctgctgtcgagcggtttggcaagatcgac
gtgctggtcaacaatgccggcattttcacgggcctcagcggtgttccgatggaaggcatc
acggtcgaggactgggacaaactctacgctgtcaatgtcaagggtccgtggctttgcacg
agcgcagtctcggcggcgatgcgtgagggcggtggcggcaagatcatcaacatcgcctcg
gtcatcgcgcacgtcggcgtgcccttcatgctgcactacgtctcgagcaagggtgccgtg
gcagccatgacccgcgcaatggcgcgggagtttgctgccaccaaggcgggaattacggtc
aacgcgatctctcccggctatacccattctgcaaacgcagtggccaatacccagcagcac
gagcagttcgaaggcgtcgccgcacagatgcgcacgatcgggcggccgcaggtgcccgag
gacattgccggcgcagcactctggctcgcgagcgacgaagcgtcctacgtcaacgggcag
aacatcattgtggacggtggcattttcatgagcctctga

DBGET integrated database retrieval system