Paraburkholderia xenovorans LB400: DR64_2287 Help Entry DR64_2287         CDS       T03290                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bxb  Paraburkholderia xenovorans LB400 Brite KEGG Orthology (KO) [BR:bxb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bxb03036]     DR64_2287    03400 DNA repair and recombination proteins [BR:bxb03400]     DR64_2287 Chromosome and associated proteins [BR:bxb03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DR64_2287 DNA repair and recombination proteins [BR:bxb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DR64_2287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N FeoB_Cyto HalX DUF5865 RPN7 FlxA Motif Other DBs NCBI-ProteinID:  AIP29716 UniProt:  Q13SX0 LinkDB All DBs Position 1:2519060..2519362 Genome browser AA seq 100 aa AA seqDB search MSQYADLKAQIAKLQAQAEEARRTEIDNVIADIRQKIAEYGLTAQDLGFAVAAKRGRPPK KAPLPAKYQDPKSGNTWSGRGKPPKWIVGKNRERFLIGAA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtctcaatatgcagacctcaaggcacagatcgccaaattgcaggcacaagcagaagaa gcgcggcgtacggaaatcgacaacgtgatcgctgacatccgccagaagatcgctgaatac ggtctgacggctcaggacctcggctttgccgtcgccgccaagcgcgggcgcccgcccaag aaggcgccgctgccggcgaaataccaggaccccaaatcgggaaatacatggagcgggcgc ggcaaaccgcccaagtggatcgtcggcaagaatcgcgagcgctttctgattggcgcggct tga

DBGET integrated database retrieval system