KEGG   Paraburkholderia xenovorans LB400: DR64_3290
Entry
DR64_3290         CDS       T03290                                 
Name
(GenBank) chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00361  Chlorocyclohexane and chlorobenzene degradation
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    DR64_3290
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     DR64_3290
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: AIP33237
UniProt: Q13VS3
LinkDB
Position
1:complement(3588754..3589536)
AA seq 260 aa
MDKRVAEVAGAIVEAVRKILLDKRVTEAEYRAGVDYLTEVAQTRETALLLDVFLNSTIIE
GKAQRSRTSAPAIQGPYFLEGAPVVEGVLKTYDTDDHKPLIIRGTVRSDTGELLAGAVID
VWHSTPDGLYSGIHDNIPVDYYRGKLVTDSQGNYRVRTTMPVPYQIPYEGPTGRLLGHLG
SHTWRPAHVHFKVRKDGFEPLTTQYYFEGGKWVDDDCCHGVTPDLITPETIEDGVRVMTL
DFVIEREQAEQRKSATETVA
NT seq 783 nt   +upstreamnt  +downstreamnt
atggataaacgagttgccgaggtcgcaggcgcgatcgtcgaggcagtacgcaaaattttg
ctggacaagcgcgtcacggaagccgaataccgcgcgggtgtcgactatctcaccgaggtc
gcacagacgcgggaaaccgcgctgcttctggacgttttcctgaacagcaccatcatcgaa
ggcaaggcgcagcgctcgcggacctctgcgcctgcgatccaggggccgtacttcctggaa
ggtgctcctgtagttgaaggcgtcctcaagacctacgataccgacgaccacaaaccgctg
atcattcgcggtacggtgcgctcggacacgggcgagttgctcgctggcgctgtcatcgac
gtgtggcactcgacgcctgatggcttgtacagcgggatccacgacaacatccccgtggac
tactaccgcggaaaactcgtgacggattcccagggcaactatcgcgtgcgcaccacgatg
ccagtgccataccagatcccctacgaggggccgactgggcgtctgctgggccacctgggc
agccatacctggcgtccggcgcacgtgcacttcaaggtgcgcaaggacggtttcgaaccg
ttgaccacgcaatactacttcgaagggggcaaatgggtggacgatgactgctgtcacggc
gtcacccccgacctgattacgcccgagacgatcgaggacggggtgcgggtcatgaccctg
gacttcgtaatcgagcgtgagcaggccgagcaacgcaagtcggctacggagacagtggca
tga

DBGET integrated database retrieval system