Paraburkholderia xenovorans LB400: DR64_3759 Help Entry DR64_3759         CDS       T03290                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bxb  Paraburkholderia xenovorans LB400 Pathway bxb02024   Quorum sensing bxb03018   RNA degradation Brite KEGG Orthology (KO) [BR:bxb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DR64_3759 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DR64_3759 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bxb03019]     DR64_3759 (hfq)    03036 Chromosome and associated proteins [BR:bxb03036]     DR64_3759 (hfq) Messenger RNA biogenesis [BR:bxb03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DR64_3759 (hfq) Chromosome and associated proteins [BR:bxb03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DR64_3759 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AIP33849 UniProt:  Q13X33 LinkDB All DBs Position 1:4093233..4093469 Genome browser AA seq 78 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFHPDSEQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgttacaagacccgtttttgaacgcactgcgtaaagagcat gtgccggtgtcgatctacctggtcaacggcatcaagcttcaagggaacatcgaatcgttc gaccagtacgtcgtgttgctccggaatacggtcacccagatggtctacaagcacgcaatc tcgactgtcgtgccagcccgcccggtgaatttccacccggattccgaacagtcctaa

DBGET integrated database retrieval system