Paraburkholderia xenovorans LB400: DR64_5110 Help Entry DR64_5110         CDS       T03290                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bxb  Paraburkholderia xenovorans LB400 Brite KEGG Orthology (KO) [BR:bxb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bxb03036]     DR64_5110    03400 DNA repair and recombination proteins [BR:bxb03400]     DR64_5110 Chromosome and associated proteins [BR:bxb03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DR64_5110 DNA repair and recombination proteins [BR:bxb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DR64_5110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AIP35790 UniProt:  Q13RS1 LinkDB All DBs Position 2:complement(744729..744992) Genome browser AA seq 87 aa AA seqDB search MKEREEQRLFDLDGNARERLIVWIRRRMDEYGITMEALAEAIEADASATRAVMYRDAYGN TWDGHGDKPDWLARAIYAGQSMDHFRC NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaagagcgagaagaacaacggctgttcgacctcgacgggaatgcgcgtgagcgcctg atcgtgtggatccgccggcgcatggacgaatacggcattacgatggaagcgctcgccgag gcgatcgaagcggatgcgtccgcaacgcgggccgtcatgtatcgcgacgcctacggcaat acctgggacggtcacggcgataagccggattggctcgcacgcgcgatttacgccggacag agcatggatcatttccgttgctaa

DBGET integrated database retrieval system