KEGG   Paraburkholderia xenovorans LB400: DR64_6085
Entry
DR64_6085         CDS       T03290                                 
Name
(GenBank) binding--dependent transport system inner membrane component family protein
  KO
K15582  oligopeptide transport system permease protein
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb01501  beta-Lactam resistance
bxb02010  ABC transporters
bxb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DR64_6085
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DR64_6085
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DR64_6085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxb02000]
    DR64_6085
Transporters [BR:bxb02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    DR64_6085
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: AIP35709
UniProt: Q13L40
LinkDB
Position
2:complement(1868953..1869867)
AA seq 304 aa
MPRSIQSTAAALDPLAAIARAPRSRGPLATAAWRFVRNRAAFAGFVMLMLIVIACVAGPW
FLPNNPIDSDWSAISLPPTLQNMHWFGTDELGRDLLARTLQGGRVSLEVGLLGTLVSGLI
GVAYGATAGYLGGRVDAVMMRIVDMMYAIPYMLIAILMMTMFGRAFYLVVLTISAFSWLD
MARVVRGQTLSLRSREFIDAAKAIGVSSRSIIARHIVPNLFGVVVVYASVTVPNIVLTES
VLSFLGLGVQEPMTSWGVLIQDGAQKLESMPWLLLCPAVMLCVTLYCVNFVGDGLRDAFD
PKDR
NT seq 915 nt   +upstreamnt  +downstreamnt
atgccccgctcaattcaatcgactgccgcggcgctcgacccgctcgcggccatcgccaga
gcgccgcgctcgcgcggcccgctcgccaccgccgcgtggcgcttcgtgcgcaaccgcgcc
gcgtttgccggcttcgtgatgctgatgctgatcgtgatcgcctgcgtagccggcccgtgg
tttctgccgaacaatccgatcgatagcgactggagcgcgatcagcctgccgcccaccttg
cagaacatgcactggttcggcaccgacgagctcggccgcgatctgctcgcgcgcacgctg
caaggcggccgcgtttcgctcgaggtcggcctgctcggcacgctcgtgtcggggctgatc
ggcgtcgcgtacggcgcgaccgccggttatctgggcggacgcgtcgacgcggtgatgatg
cgcatcgtcgacatgatgtacgcgattccctacatgctgatcgcgatcctgatgatgacc
atgttcggccgcgcgttctacctggtcgtgctcaccatcagcgcgttctcgtggctcgac
atggcgcgcgtggtgcgcggccagacactgtcgctgcgctcgcgcgaattcatcgacgcc
gcgaaggcgatcggcgtgagttcgcgttcgatcatcgcgcgtcacatcgtgccgaatctg
ttcggcgtggtcgtggtgtacgcgagcgtgacggtgccgaacatcgtgctgacggaatcg
gtgctgtcgtttctcggcctcggcgtacaggagccgatgacgagctggggcgtgctgatt
caggacggcgcgcagaagctcgaatccatgccctggctgctgctgtgtcccgccgtgatg
ttgtgcgtgacgctgtattgcgtgaatttcgtcggcgacggtttgcgcgatgcattcgat
ccgaaggaccgttga

DBGET integrated database retrieval system