Paraburkholderia xenovorans LB400: DR64_8291 Help Entry DR64_8291         CDS       T03290                                  Name (GenBank) chaperonin 10 Kd subunit   KO K04078   chaperonin GroES Organism bxb  Paraburkholderia xenovorans LB400 Brite KEGG Orthology (KO) [BR:bxb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bxb03110]     DR64_8291    03029 Mitochondrial biogenesis [BR:bxb03029]     DR64_8291 Chaperones and folding catalysts [BR:bxb03110]  Heat shock proteins   HSP10    DR64_8291 Mitochondrial biogenesis [BR:bxb03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     DR64_8291 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AIP34610 UniProt:  Q13IM8 LinkDB All DBs Position 3:919360..919650 Genome browser AA seq 96 aa AA seqDB search MSLRPLHDRLIVKRLDQETKTASGIVIPESAAEKPDQGEVIAIGPGKRDSDGKRIEPDLK VGERVLFGKYAGQSVKVDGTELLVLREEDVVAVVTQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgagcctacgtccattgcacgaccgcctgatcgtcaaacgtcttgatcaggaaaccaaa acagcatcgggaatcgtcattcccgaaagcgcggcggaaaaacccgaccagggcgaagtc atcgccatcggaccgggcaagcgtgatagcgacggcaagcgtatcgaacccgatctgaag gttggcgagcgtgtgctgttcggcaaatacgcgggccagtcggtgaaggtggatggcacc gaactgctggtgctgcgcgaagaagacgtggtcgccgtcgttactcaataa

DBGET integrated database retrieval system