KEGG   Paraburkholderia xenovorans LB400: DR64_8614
Entry
DR64_8614         CDS       T03290                                 

Gene name
bphC
Definition
(GenBank) 2,3-dihydroxybiphenyl 1,2-dioxygenase
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00361  Chlorocyclohexane and chlorobenzene degradation
bxb00621  Dioxin degradation
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
bxb01220  Degradation of aromatic compounds
Module
bxb_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    DR64_8614 (bphC)
   00621 Dioxin degradation
    DR64_8614 (bphC)
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.39  biphenyl-2,3-diol 1,2-dioxygenase
     DR64_8614 (bphC)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_6
Other DBs
NCBI-ProteinID: AIP34030
UniProt: P47228
LinkDB
Structure
PDB: 

Position
3:1291752..1292648
AA seq 298 aa
MSIRSLGYMGFAVSDVAAWRSFLTQKLGLMEAGTTDNGDLFRIDSRAWRIAVQQGEVDDL
AFAGYEVADAAGLAQMADKLKQAGIAVTTGDASLARRRGVTGLITFADPFGLPLEIYYGA
SEVFEKPFLPGAAVSGFLTGEQGLGHFVRCVPDSDKALAFYTDVLGFQLSDVIDMKMGPD
VTVPAYFLHCNERHHTLAIAAFPLPKRIHHFMLEVASLDDVGFAFDRVDADGLITSTLGR
HTNDHMVSFYASTPSGVEVEYGWSARTVDRSWVVVRHDSPSMWGHKSVRDKAAARNKA
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagcatcagaagtttgggatacatggggtttgcggtcagcgacgtagctgcttggcgt
tcgtttctgacgcagaaactgggcttgatggaagcgggcacgaccgacaacggcgacctg
ttccgcatcgattcgagagcctggcggatcgccgttcagcagggcgaggttgacgatctg
gcctttgccggctacgaggtggccgatgcggcagggctggcgcagatggctgacaagctc
aaacaggccggtatcgcagtcaccaccggcgatgcctcattggccaggcgccgcggggtg
accggattgatcacctttgccgacccgtttggcctgccgttggaaatttactatggcgcc
agcgaggtgttcgaaaaaccgttcctgcctggtgcggccgtgtcgggtttcctgaccggc
gagcaagggctggggcatttcgtgcgctgcgttccggattcggacaaggcgctggcgttt
tataccgacgtgctcggcttccagttgtctgacgtcatcgacatgaaaatggggccggac
gtgacggttcctgcgtacttcctgcactgcaacgaacgccaccacaccctggcaattgcg
gcattcccgctgccaaaacgcattcatcacttcatgctcgaagtcgcctcgctcgatgac
gtcggctttgcatttgatcgggttgacgcggacggcttgatcacctccacgctggggcgc
cacaccaatgaccacatggtgtcgttctatgcctcgaccccgtccggagtagaggtcgag
tatggctggagtgcccgtaccgttgaccgctcctgggttgtggtgaggcacgacagtccg
agcatgtggggccacaagtctgtgcgcgacaaagcagctgcgcgcaacaaagcatga

DBGET integrated database retrieval system