KEGG   Paraburkholderia xenovorans LB400: Bxe_A1130
Entry
Bxe_A1130         CDS       T00340                                 
Symbol
clcA
Name
(GenBank) 3-chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00361  Chlorocyclohexane and chlorobenzene degradation
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bxe_A1130 (clcA)
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     Bxe_A1130 (clcA)
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: ABE31816
UniProt: Q13VS3
LinkDB
Position
1:3650281..3651063
AA seq 260 aa
MDKRVAEVAGAIVEAVRKILLDKRVTEAEYRAGVDYLTEVAQTRETALLLDVFLNSTIIE
GKAQRSRTSAPAIQGPYFLEGAPVVEGVLKTYDTDDHKPLIIRGTVRSDTGELLAGAVID
VWHSTPDGLYSGIHDNIPVDYYRGKLVTDSQGNYRVRTTMPVPYQIPYEGPTGRLLGHLG
SHTWRPAHVHFKVRKDGFEPLTTQYYFEGGKWVDDDCCHGVTPDLITPETIEDGVRVMTL
DFVIEREQAEQRKSATETVA
NT seq 783 nt   +upstreamnt  +downstreamnt
atggataaacgagttgccgaggtcgcaggcgcgatcgtcgaggcagtacgcaaaattttg
ctggacaagcgcgtcacggaagccgaataccgcgcgggtgtcgactatctcaccgaggtc
gcacagacgcgggaaaccgcgctgcttctggacgttttcctgaacagcaccatcatcgaa
ggcaaggcgcagcgctcgcggacctctgcgcctgcgatccaggggccgtacttcctggaa
ggtgctcctgtagttgaaggcgtcctcaagacctacgataccgacgaccacaaaccgctg
atcattcgcggtacggtgcgctcggacacgggcgagttgctcgctggcgctgtcatcgac
gtgtggcactcgacgcctgatggcttgtacagcgggatccacgacaacatccccgtggac
tactaccgcggaaaactcgtgacggattcccagggcaactatcgcgtgcgcaccacgatg
ccagtgccataccagatcccctacgaggggccgactgggcgtctgctgggccacctgggc
agccatacctggcgtccggcgcacgtgcacttcaaggtgcgcaaggacggtttcgaaccg
ttgaccacgcaatactacttcgaagggggcaaatgggtggacgatgactgctgtcacggc
gtcacccccgacctgattacgcccgagacgatcgaggacggggtgcgggtcatgaccctg
gacttcgtaatcgagcgtgagcaggccgagcaacgcaagtcggctacggagacagtggca
tga

DBGET integrated database retrieval system