Paraburkholderia xenovorans LB400: Bxe_A1994 Help Entry Bxe_A1994         CDS       T00340                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bxe  Paraburkholderia xenovorans LB400 Pathway bxe00190   Oxidative phosphorylation bxe01100   Metabolic pathways bxe02020   Two-component system Module bxe_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bxe00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Bxe_A1994  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Bxe_A1994 Enzymes [BR:bxe01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Bxe_A1994 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABE30972 UniProt:  Q13Y67 LinkDB All DBs Position 1:2725774..2726055 Genome browser AA seq 93 aa AA seqDB search MIATRARSASLAEWTTPCPLAWRRVLLHDRCKGQFRKLPVKETAMWYFTWILGIGVALGF GIINVMWLEAGGKFARDPQRADTIAATPGDTPS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgatagcaacgcgagcccgttccgccagcctggccgaatggacgaccccatgccccctt gcgtggcgccgcgttcttcttcatgatcgctgcaaagggcagttccgtaagctgccggtc aaggagacagcaatgtggtatttcacatggattctcggcattggcgtggcattgggcttc ggcatcatcaacgtgatgtggctggaggccggcggcaagttcgcgcgtgacccgcagcgc gccgacaccatcgccgccacgcccggagacacgccttcgtga

DBGET integrated database retrieval system