Paraburkholderia xenovorans LB400: Bxe_A2592 Help Entry Bxe_A2592         CDS       T00340                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism bxe  Paraburkholderia xenovorans LB400 Brite KEGG Orthology (KO) [BR:bxe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bxe03036]     Bxe_A2592    03400 DNA repair and recombination proteins [BR:bxe03400]     Bxe_A2592 Chromosome and associated proteins [BR:bxe03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     Bxe_A2592 DNA repair and recombination proteins [BR:bxe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       Bxe_A2592 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  ABE30388 UniProt:  Q13ZV1 LinkDB All DBs Position 1:2073703..2073996 Genome browser AA seq 97 aa AA seqDB search MIAYLRHRMDDFGISPDDLAAVLAAEPAGGRYRSANGDSWSGEGTMPQWLKQAISAGQSI GHFELSSGSASRPPLPAGADWTNDPFAGSPLARPNPR NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgattgcctatctccgtcaccgcatggatgacttcggcatcagcccggacgatctggct gcagtactcgcggccgaaccggcaggcggccgctaccgcagcgcgaatggcgatagctgg agcggcgaagggacgatgccacaatggctgaagcaggcgatcagtgccggacagtccatt gggcactttgaactgtcatcagggtcggcttccaggccaccgctgccggcgggtgcagac tggactaacgacccgttcgccggcagtccactcgcgcggccgaacccccgttag

DBGET integrated database retrieval system