KEGG   Paraburkholderia xenovorans LB400: Bxe_A3563
Entry
Bxe_A3563         CDS       T00340                                 
Name
(GenBank) p-cumic alcohol dehydrogenase (CymB)
  KO
K10617  p-cumic alcohol dehydrogenase
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00622  Xylene degradation
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01220  Degradation of aromatic compounds
Module
bxe_M00419  Cymene degradation, p-cymene => p-cumate
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    Bxe_A3563
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DFP
Other DBs
NCBI-ProteinID: ABE29425
UniProt: Q143R4
LinkDB
Position
1:998295..999053
AA seq 252 aa
MRLEGKVAIITGAATGIGNAIARAYVAEGAKVVIADLKGAEAAASELGAGIALGIYANVA
DPDSTRQMAAAAVERFGKIDVLVNNAGIFTGLSGVPMEGITVEDWDKLYAVNVKGPWLCT
SAVSAAMREGGGGKIINIASVIAHVGVPFMLHYVSSKGAVAAMTRAMAREFAATKAGITV
NAISPGYTHSANAVANTQQHEQFEGVAAQMRTIGRPQVPEDIAGAALWLASDEASYVNGQ
NIIVDGGIFMSL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagacttgaaggcaaggtggcgatcatcaccggtgcggcaaccggtatcggcaacgcg
atcgcgcgggcgtatgtggccgaaggtgcgaaggtcgtgattgcagacctgaagggggcg
gaggcagcggcatctgaacttggcgcgggtattgcgctaggtatttacgccaacgtcgcc
gatccggacagcaccaggcagatggctgctgctgctgtcgagcggtttggcaagatcgac
gtgctggtcaacaatgccggcattttcacgggcctcagcggtgttccgatggaaggcatc
acggtcgaggactgggacaaactctacgctgtcaatgtcaagggtccgtggctttgcacg
agcgcagtctcggcggcgatgcgtgagggcggtggcggcaagatcatcaacatcgcctcg
gtcatcgcgcacgtcggcgtgcccttcatgctgcactacgtctcgagcaagggtgccgtg
gcagccatgacccgcgcaatggcgcgggagtttgctgccaccaaggcgggaattacggtc
aacgcgatctctcccggctatacccattctgcaaacgcagtggccaatacccagcagcac
gagcagttcgaaggcgtcgccgcacagatgcgcacgatcgggcggccgcaggtgcccgag
gacattgccggcgcagcactctggctcgcgagcgacgaagcgtcctacgtcaacgggcag
aacatcattgtggacggtggcattttcatgagcctctga

DBGET integrated database retrieval system