Paraburkholderia xenovorans LB400: Bxe_A3959
Help
Entry
Bxe_A3959 CDS
T00340
Name
(GenBank) Para-aminobenzoate synthase, component I
KO
K03342
para-aminobenzoate synthetase / 4-amino-4-deoxychorismate lyase [EC:
2.6.1.85
4.1.3.38
]
Organism
bxe
Paraburkholderia xenovorans LB400
Pathway
bxe00790
Folate biosynthesis
bxe01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
bxe00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00790 Folate biosynthesis
Bxe_A3959
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
bxe01007
]
Bxe_A3959
Enzymes [BR:
bxe01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.85 aminodeoxychorismate synthase
Bxe_A3959
4. Lyases
4.1 Carbon-carbon lyases
4.1.3 Oxo-acid-lyases
4.1.3.38 aminodeoxychorismate lyase
Bxe_A3959
Amino acid related enzymes [BR:
bxe01007
]
Aminotransferase (transaminase)
Class IV
Bxe_A3959
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Chorismate_bind
Aminotran_4
Lon_lid
Motif
Other DBs
NCBI-ProteinID:
ABE29040
UniProt:
Q145E9
LinkDB
All DBs
Position
1:568499..570421
Genome browser
AA seq
640 aa
AA seq
DB search
MTADEHSAVFALLDDCDATAARPSSRLYTGFVHEWVCTQAAQLEAVCESVAAQTRRGLHA
VVLADYEFGRNLLDIKSHRSPKTQRGDATLRFLLFEHCEKRSREQVDAWLMARDEGAAEP
SVAGTANVRASVDPAQFNAAIGAIHAALEAGDSYQVNYTYRLGFDVFGSPTALYRRLRAR
QPVRYGALIALPDGDWVLSCSPELFVEKQGSVLHARPMKGTAPRSDDPAVDRSTAEFLGN
DPKNRAENVMIVDLLRNDLSRVAQTGSVKVPALFSVEPYATVWQMTSTVHAELRSGTSFA
GLLRALFPCGSITGAPKHRTMQLIDELESTPRGLYTGAIGWLDGHSAATGATGAHTPASA
ANETACGDFCLSVAIRTLTLSRSAQNGQLEGRMGIGAGIVLDSVAADEYAECQLKARFLT
NAEPGFELFETMYATREEGVRHLSRHLARLASSAAALGFKLEDANVMGAEIAAKCASLPA
NIPHRMRVALSKNGTAQITAAVLAPLGESTVGVLLGPDHAFPATDAGDLLLRHKTTRRAE
YDRGWREAEAKGAFDTLFFNAQGELTEGGRSNVFVKLAGRWWTPPLASGVLPGVMRSVLL
DEASDLHAAERVLTRADLQNAEALMVCNALRGAVPARLVD
NT seq
1923 nt
NT seq
+upstream
nt +downstream
nt
atgacggcagatgagcacagcgcggtttttgcgttgctcgacgattgcgacgcaacggcg
gcgcgcccctcgagtcgtctgtacacgggttttgtgcatgaatgggtgtgtacgcaagcc
gcgcagctcgaagccgtatgcgagagcgtggctgcgcaaacgcggcgtggcttgcatgcc
gtcgtactggccgactatgagttcggacggaatcttctcgatataaagtcgcaccggtct
ccgaaaacgcagcgtggcgatgccacgctgcgttttttattgttcgaacattgtgaaaag
cgttcgcgcgaacaggtcgacgcgtggctaatggcgcgcgacgaaggcgcggccgagcct
tcggtggcgggcacggccaacgtgcgcgcaagcgtcgatccggcgcagttcaacgcggcg
atcggcgcgatccacgcggcgctggaggcgggcgattcgtatcaggtcaactacacgtat
cggctcggcttcgatgtattcggctcgcccaccgcgctataccggcggctgagggcgcgt
cagccggtccggtacggggcgctcatcgcattgccggacggtgactgggtgctgtcgtgc
tcgccggaactgttcgttgaaaagcagggctcggtgttgcatgcgcggccgatgaaaggc
acggcgccgcgctcggacgacccggcggttgaccggagcacggccgaattcctcggcaac
gatccgaaaaaccgcgccgaaaacgtgatgatcgtcgacctgttgcgcaacgatctgtcg
cgcgtggcccaaaccggctcggtcaaggtgccggcgctcttttcggtcgagccctatgcg
acggtctggcagatgacctcgacggtgcatgcggaactgcggtccggcacctcgtttgcc
gggctgctgcgcgcgctgtttccctgcggatcgatcacgggtgcgccgaagcatcgcacg
atgcagttgatcgatgaactcgaaagcacgccgcgtgggctctataccggcgccattggc
tggctggatgggcactcggcggccaccggcgccacgggcgcacacacacccgcttccgct
gcgaacgaaaccgcctgtggcgatttctgcctgtccgtcgcgattcgcacgttgacgttg
agccgctcggcgcaaaacggccagctggagggcagaatgggcattggtgcgggcatcgtg
ctcgacagcgtcgccgccgacgaatacgcggagtgtcaattgaaagcccgatttctgacc
aacgccgagccgggcttcgagctcttcgaaacgatgtatgcaacacgcgaagagggcgtg
cggcatctatcgcgccatctggcgcgactcgcgtcgagcgctgcggcgctcggcttcaaa
ctcgaggatgcaaacgtcatgggtgcagagatcgcggcgaagtgcgcgtcgctgcccgcg
aatattccgcatcgcatgcgcgttgcgctgagcaaaaacggcacggcgcaaatcaccgcg
gccgtgctggcgccgttaggtgaatcgactgtaggcgtgttgcttgggcccgatcatgcg
ttcccggcaaccgacgccggcgacctgctgctgcgccacaaaaccactcgccgcgccgaa
tacgatcgcggctggcgcgaagccgaagcgaagggcgcgttcgacacgctgttctttaac
gcgcaaggcgagttgaccgagggcggccggtcgaatgtcttcgtgaagttggcggggcgc
tggtggaccccgccgcttgcgtcgggcgtattgcccggcgtgatgcgcagcgttctgctc
gacgaggcgtcggacctgcacgcggccgaacgtgtgttgacccgcgccgatctgcaaaac
gcggaggcgctgatggtgtgcaacgcgctgcgaggcgccgtgccggcgcggctcgtggac
tga
DBGET
integrated database retrieval system