Paraburkholderia xenovorans LB400: Bxe_B0956 Help Entry Bxe_B0956         CDS       T00340                                  Name (GenBank) DNA-binding protein HU-alpha   KO K03530   DNA-binding protein HU-beta Organism bxe  Paraburkholderia xenovorans LB400 Brite KEGG Orthology (KO) [BR:bxe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bxe03032]     Bxe_B0956    03036 Chromosome and associated proteins [BR:bxe03036]     Bxe_B0956    03400 DNA repair and recombination proteins [BR:bxe03400]     Bxe_B0956 DNA replication proteins [BR:bxe03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Bxe_B0956 Chromosome and associated proteins [BR:bxe03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     Bxe_B0956 DNA repair and recombination proteins [BR:bxe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       Bxe_B0956 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  ABE34998 UniProt:  Q13LP1 LinkDB All DBs Position 2:complement(2304930..2305208) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAATGESKAATGQTIDAIVEAVTKAVVGGDTVQLVGFGSFSTGARAARVG RNPSTGAEIQIAAAKTVKFTAGKAFKEAVNAS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgattgatgcagtcgccgcagcgacgggcgaaagcaaagcggcc accggccaaaccatcgacgcgatcgtcgaagcggtgaccaaggccgtggtgggtggcgat acggtgcaactggtcggtttcggttctttctcgaccggcgcgcgcgcagcacgcgtgggc cgcaatccgtcgacgggtgccgagatccagatcgcggctgccaagacggtgaagttcacc gccggcaaggcgttcaaggaagccgtcaacgcgtcgtaa

DBGET integrated database retrieval system