KEGG   Paraburkholderia xenovorans LB400: Bxe_C1191
Entry
Bxe_C1191         CDS       T00340                                 

Gene name
bphC
Definition
(GenBank) 2,3-Dihydroxybiphenyl-1,2-dioxygenase (BphC)
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00361  Chlorocyclohexane and chlorobenzene degradation
bxe00621  Dioxin degradation
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01220  Degradation of aromatic compounds
Module
bxe_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bxe_C1191 (bphC)
   00621 Dioxin degradation
    Bxe_C1191 (bphC)
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.39  biphenyl-2,3-diol 1,2-dioxygenase
     Bxe_C1191 (bphC)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_6
Other DBs
NCBI-ProteinID: ABE37053
UniProt: P47228
LinkDB
Structure
PDB: 

Position
3:complement(1248429..1249325)
AA seq 298 aa
MSIRSLGYMGFAVSDVAAWRSFLTQKLGLMEAGTTDNGDLFRIDSRAWRIAVQQGEVDDL
AFAGYEVADAAGLAQMADKLKQAGIAVTTGDASLARRRGVTGLITFADPFGLPLEIYYGA
SEVFEKPFLPGAAVSGFLTGEQGLGHFVRCVPDSDKALAFYTDVLGFQLSDVIDMKMGPD
VTVPAYFLHCNERHHTLAIAAFPLPKRIHHFMLEVASLDDVGFAFDRVDADGLITSTLGR
HTNDHMVSFYASTPSGVEVEYGWSARTVDRSWVVVRHDSPSMWGHKSVRDKAAARNKA
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagcatcagaagtttgggatacatggggtttgcggtcagcgacgtagctgcttggcgt
tcgtttctgacgcagaaactgggcttgatggaagcgggcacgaccgacaacggcgacctg
ttccgcatcgattcgagagcctggcggatcgccgttcagcagggcgaggttgacgatctg
gcctttgccggctacgaggtggccgatgcggcagggctggcgcagatggctgacaagctc
aaacaggccggtatcgcagtcaccaccggcgatgcctcattggccaggcgccgcggggtg
accggattgatcacctttgccgacccgtttggcctgccgttggaaatttactatggcgcc
agcgaggtgttcgaaaaaccgttcctgcctggtgcggccgtgtcgggtttcctgaccggc
gagcaagggctggggcatttcgtgcgctgcgttccggattcggacaaggcgctggcgttt
tataccgacgtgctcggcttccagttgtctgacgtcatcgacatgaaaatggggccggac
gtgacggttcctgcgtacttcctgcactgcaacgaacgccaccacaccctggcaattgcg
gcattcccgctgccaaaacgcattcatcacttcatgctcgaagtcgcctcgctcgatgac
gtcggctttgcatttgatcgggttgacgcggacggcttgatcacctccacgctggggcgc
cacaccaatgaccacatggtgtcgttctatgcctcgaccccgtccggagtagaggtcgag
tatggctggagtgcccgtaccgttgaccgctcctgggttgtggtgaggcacgacagtccg
agcatgtggggccacaagtctgtgcgcgacaaagcagctgcgcgcaacaaagcatga

DBGET integrated database retrieval system