KEGG   Paraburkholderia xenovorans LB400: Bxe_C1196
Entry
Bxe_C1196         CDS       T00340                                 

Gene name
bphA2
Definition
(GenBank) Biphenyl 2,3-dioxygenase small subunit (BphA2)
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00621  Dioxin degradation
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01220  Degradation of aromatic compounds
Module
bxe_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Bxe_C1196 (bphA2)
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     Bxe_C1196 (bphA2)
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: ABE37058
UniProt: P37334
LinkDB
Structure
PDB: 

Position
3:complement(1252311..1252952)
AA seq 213 aa
MVGWTCMCRRRAEVPSPDIYLEITVMTNPSPHFFKTFEWPSKAAGLELQNEIEQFYYREA
QLLDHRAYEAWFALLDKDIHYFMPLRTNRMIREGELEYSGDQDLAHFDETHETMYGRIRK
VTSDVGWAENPPSRTRHLVSNVIVKETATPDTFEVNSAFILYRNRLERQVDIFAGERRDV
LRRADNNLGFSIAKRTILLDASTLLSNNLSMFF
NT seq 642 nt   +upstreamnt  +downstreamnt
atggtgggctggacgtgcatgtgcagacggcgcgccgaggttccgtcccctgatatttac
ttggagataactgttatgacaaatccatccccgcattttttcaaaacatttgaatggcca
agcaaggcggctggccttgagttgcagaacgagatcgagcagttctactaccgcgaagcg
cagttgcttgaccaccgggcctacgaggcctggtttgccctgctggacaaagatatccac
tacttcatgccgctgcgcaccaatcgcatgatccgggagggcgagctggaatattccggc
gaccaggatttagcccatttcgatgaaacccatgaaaccatgtacgggcgcatccgcaag
gtgacctcggacgtgggctgggcggagaacccgccttcccgcacgcgccacctggtctcc
aacgtcatcgtcaaggagacggccacgccggataccttcgaggtcaattccgcattcatc
ctgtaccgcaatcggcttgagcgccaggtcgacatcttcgcgggcgaacgccgggacgtg
ctgcgccgcgccgacaacaaccttggtttcagcatcgccaagcgcaccatcctgctcgac
gccagtaccttgctgtcgaacaacctgagcatgttcttctag

DBGET integrated database retrieval system