Bradyrhizobium xenonodulans: I3J27_07760 Help Entry I3J27_07760       CDS       T09324                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bxn  Bradyrhizobium xenonodulans Pathway bxn00998   Biosynthesis of various antibiotics bxn01100   Metabolic pathways bxn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bxn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I3J27_07760    00074 Mycolic acid biosynthesis     I3J27_07760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I3J27_07760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WBL80307 LinkDB All DBs Position complement(1640542..1640781) Genome browser AA seq 79 aa AA seqDB search MDQAHIYTKLTSVFRDVFDEDDLALTAATTADDVDGWDSLSHIRLVLAVSKSFGVKFSAS EIGGLKNVGEFVELIQKKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggatcaagctcacatctacaccaagctcacatcagtcttccgcgacgtgttcgatgag gacgacctcgctctgaccgcggcgaccacggccgatgatgttgacggctgggatagcctg tctcacattcgtctcgttctagcggtctcgaaatcgtttggcgtcaaattttccgcatct gagatcggcggactaaagaacgtcggagagttcgtcgagctcattcagaagaaggcgtga

DBGET integrated database retrieval system