KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_1970
Entry
BANAU_1970        CDS       T02050                                 
Symbol
fenB2
Name
(GenBank) fengycin synthetase B, partial
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BANAU_1970 (fenB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bya01008]
    BANAU_1970 (fenB2)
Polyketide biosynthesis proteins [BR:bya01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BANAU_1970 (fenB2)
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: CCG49991
LinkDB
Position
complement(2164183..2167332)
AA seq 1049 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTINGQLDRERFQKSIDAVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDKYADRFRKEDKDKGFDLQ
SDPLMRVSILKKAPERYVCIWSHHHIVMDGWCFGIVMKEFLMIYQSLGDGRLPSLEPVQP
YGKYIKWLMKQDRKEAEIFWKTRLADLEQSASLPKKSAEPNGELEQAVFTISEEQTNELK
NIAARAGATLNTVFQALWGMLLQRVSRCDDAVFGSVVSGRPSDLAGVEKMVGLFINTIPV
RVKSGSLSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQAGSFDFAVEDFTMEEVTNYGCSIKVIPGSSLYIRLNFDTGIYDRVFMKNIETFLR
HMMKSVISAPEMSASEIALLDACEARNMLDAFNRTEAVEPPAPTLHGLFTRRAALSPHRP
ALRFPGGMLTYAELDQYTDRLAVWLRQKGVRKESMVGVLAERSPEMVVSVLAVLKAGGAY
VPLDPDYPEDRLRYMLDDCGACLLLAQPGLSLSGFSGETLEVSLSSLTSETETGAVSEEA
DADSLAYIIYTSGSTGTPKGVAVEHCQAAAFLSGMQGQFPLTEEDIIVLKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPVRMIEAFASEKVTTAHFIPAMVNSFLDALETEPEETR
TRLGRTLTRVFAGGEALSPLTAARFADLLPETMLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFLDDPFY
PGERMYQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTAR
TEHGETALYAYIEGRESDDVRAELATRLPAYMMPAQFIEMSEWPVTPSGKLDRRALPAPG
GAADRRAYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFG
VQVPLQDIFARPTVEELGFGYSGLGREPV
NT seq 3150 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttatcttttatgcaggagggcatg
ctttttcattctctgttggatcatgactcaagagcctacttcgaacaagcggtgtttacg
atcaacggacagcttgaccgggaacgattccaaaaaagtatagatgctgtttttgaacga
tacgatattttccgtacgacatttattcataagaatgtggcgaagccccgccaagtcgtg
ttgaaaaacaggccgagccgcgttcagttccatgatatttctcatttggacgagaaggca
caagacaaatatgccgaccggttcagaaaagaagataaagataaaggctttgatttgcaa
tcagaccctctcatgagagtctccattttgaaaaaagcgcctgaacgctatgtttgtata
tggagccatcatcatatcgtcatggacggctggtgcttcggaattgtcatgaaggaattt
ctgatgatctatcaatctctcggagacggacggctcccgtctctcgagcctgttcagcca
tatggaaagtatattaaatggctcatgaagcaggatcgtaaagaagccgagattttttgg
aaaacgagacttgccgatcttgagcaatcggcgtctcttccgaaaaaatctgcagaacca
aatggcgaacttgagcaggcggttttcaccatttcggaagagcagacaaatgagctgaaa
aacattgcggcaagggcgggagcaacgctgaatacagtgttccaggcactgtggggcatg
ttgctgcagcgtgtcagccgctgtgatgacgccgttttcggttctgtcgtttccggccgg
ccgtcggatctcgcaggcgtggaaaaaatggtgggactgtttatcaatacgattcccgtg
cgggtgaaaagcggttcattatcttttctggagctcgtcaggcatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaggcgcaaagccctttg
aagcaagcgctgtttgaccacattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcaggccggttcatttgattttgcggtagaagatttcacgatggaggaa
gtcacaaactacggatgcagcataaaggtgattccgggaagttctctttatatccgctta
aactttgataccggtatatacgatcgtgtttttatgaagaatattgaaacatttttacgg
catatgatgaagtcagtcatttccgcccctgaaatgagcgcctccgagatcgcattgctg
gatgcgtgtgaagccagaaatatgctggatgcgtttaaccgtacagaagcggttgaaccg
ccggctccgacgcttcacgggctgttcacccgccgcgccgcgctttcgccgcatcgtcct
gcgctccgttttccgggcggtatgctgacgtacgccgagcttgaccagtacacagacagg
ctcgccgtttggctccgccaaaaaggcgtccgcaaagaaagcatggtcggcgtactcgct
gaacgctcgccggagatggtggtttcagtgcttgccgtgttaaaagcgggcggcgcctat
gtgccgcttgacccggactatcctgaggacaggctgcgctatatgcttgatgactgcggc
gcctgcctcctgcttgcacagccggggttatccctttccggtttttccggagaaacgcta
gaagtgtctctttcttctttgacaagtgagacggagacaggggctgtctctgaagaagcg
gatgctgattcgctcgcttatatcatttatacgtccggttcgacgggaacaccgaaggga
gtggctgttgaacactgtcaggccgccgcctttttatcagggatgcaagggcagttcccg
ttaacggaagaggacatcatcgtgctgaaatcatccttttcattcgacgcctccatctgg
caattgttttggtggacgatgtccggcgcctccgtgtatctgcttcctgccggatgggag
aaagatcctgtgcggatgattgaagcgtttgcctcagaaaaggtgacgaccgcgcatttt
attccggcgatggtcaacagctttttagacgcgctggaaacagagcctgaggaaacaaga
acacgcctcggcagaacactgacacgcgtgtttgccggaggggaagctctttccccgctt
acggctgcccggtttgccgatctgttgccggagaccatgcttattcacggctacggaccg
acagaagcgacggttgatgcggcgttttacgtctgtgaccgaaaacgggacagcggacgg
acaaggcttccgatcggaaaacccgttcctggtgcccgtctgtatgtattagatagcgga
ggaaccatccagcctgcgggtgtggcaggagagctttacatcgcagggacaggggtggcc
cggggctatctgaaccggcctgagctgacggaggagcgttttctcgatgatccgttttat
ccgggcgagcgcatgtatcagacgggcgatatcgcacgctggacagaagatggccttgtc
gaatggctcggccgttcagacggacaagtgaaagtccgaggctaccggattgaaccgggg
gaaatcgaagcggcgatccggcgcatcgacggcattcgtgaggcggcagtcaccgcccgg
accgaacacggcgaaaccgcgctttacgcttatatcgaaggacgggaaagcgatgacgtg
cgggcggagcttgcgacacgccttccggcctacatgatgccggctcagttcatagagatg
agcgaatggccggtcacgccgagcggaaagcttgaccgccgcgcactgccggctcccggc
ggagcggcagacagacgggcgtacaccgccccgaggaacgtcacggaaatgaagctttgc
gccctctgggaagaggtgctgaaaaacggccccgtcggcatccgggatcacttttttgag
cggggcggccattcgttaaaagcgacggctctcgtctcccgcatcgccaaagaattcggt
gttcaggtgccgttacaggacatcttcgcccggccgacggtggaagagctcggcttcggt
tattcaggacttggaagagagcccgtatga

DBGET integrated database retrieval system