Burkholderia sp. YI23: BYI23_A003380 Help Entry BYI23_A003380     CDS       T01711                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism byi  Burkholderia sp. YI23 Brite KEGG Orthology (KO) [BR:byi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:byi03000]     BYI23_A003380    03036 Chromosome and associated proteins [BR:byi03036]     BYI23_A003380    03400 DNA repair and recombination proteins [BR:byi03400]     BYI23_A003380 Transcription factors [BR:byi03000]  Prokaryotic type   Helix-turn-helix    Other families     BYI23_A003380 Chromosome and associated proteins [BR:byi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BYI23_A003380 DNA repair and recombination proteins [BR:byi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       BYI23_A003380 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 Fis_N HTH_30 HTH_17 Phage_NinH NUMOD1 Xre-like-HTH B2 Motif Other DBs NCBI-ProteinID:  AET88176 LinkDB All DBs Position 1:complement(376419..376652) Genome browser AA seq 77 aa AA seqDB search MSRHNIEQCVRQSLDNYFQDLDGSNPHDVYDMVISCVEKPMLEVVLEQAGGNQSLAAEYL GINRNTLRKKLQQHGLI NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcagacataacatcgaacaatgcgtccgccagagcctcgacaactactttcaggac ctggacggctccaacccgcacgacgtgtacgacatggtgatttcgtgcgtggaaaaaccg atgctcgaagtcgtgctcgagcaggcgggcggaaatcaatcgctcgcggccgagtatctc ggcatcaaccgcaacacgctacgcaagaagcttcagcagcacggattgatttga

DBGET integrated database retrieval system