Burkholderia sp. YI23: BYI23_A019040 Help Entry BYI23_A019040     CDS       T01711                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism byi  Burkholderia sp. YI23 Pathway byi00998   Biosynthesis of various antibiotics byi01100   Metabolic pathways byi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:byi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BYI23_A019040    00074 Mycolic acid biosynthesis     BYI23_A019040   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BYI23_A019040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AET89742 LinkDB All DBs Position 1:complement(2148188..2148427) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacagcgcgtgaagaagatcgtcgccgaacaactgggcgtggcggaa gccgaaatcaagaacgaagcttcgttcgtgaacgatctgggcgctgactcgctcgatacg gtcgaactcgtgatggcgctggaagacgaattcggcatggaaattcccgatgaagaggcg gaaaagatcaccacggttcagcaggcgatcgactacgctcgcgcgaacgtcaaggcctga

DBGET integrated database retrieval system