Burkholderia sp. YI23: BYI23_D004530 Help Entry BYI23_D004530     CDS       T01711                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism byi  Burkholderia sp. YI23 Pathway byi00998   Biosynthesis of various antibiotics byi01100   Metabolic pathways byi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:byi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BYI23_D004530    00074 Mycolic acid biosynthesis     BYI23_D004530   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BYI23_D004530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AET93963 LinkDB All DBs Position byi_1p:536627..536887 Genome browser AA seq 86 aa AA seqDB search MNELERELAELIVAELNLEDVDPKAVSADTRLYEEGFGLDSIDILEIALLISKKYGFELR SDNPDNQKIFANLGALAAHVAAHRTR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaatgaactggaaagagagctcgccgagctgatcgtcgccgaactgaacctcgaagac gtcgatcccaaggccgtctcggccgatacgcgcctgtacgaagaggggttcggactcgat tccatcgacatcctggaaatcgcgctcctcatctcgaagaagtacggcttcgagctgcgc tcggacaatcccgacaaccagaaaatcttcgcgaacctgggcgcgctcgcggcgcacgtc gccgcgcatcgcacgcgataa

DBGET integrated database retrieval system