Burkholderia sp. YI23: BYI23_D014380 Help Entry BYI23_D014380     CDS       T01711                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism byi  Burkholderia sp. YI23 Brite KEGG Orthology (KO) [BR:byi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:byi03032]     BYI23_D014380    03036 Chromosome and associated proteins [BR:byi03036]     BYI23_D014380    03400 DNA repair and recombination proteins [BR:byi03400]     BYI23_D014380 DNA replication proteins [BR:byi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BYI23_D014380 Chromosome and associated proteins [BR:byi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BYI23_D014380 DNA repair and recombination proteins [BR:byi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BYI23_D014380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AET94948 LinkDB All DBs Position byi_1p:1650984..1651262 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVASESGTSKVAAEETINAVFETISKAVAAGDAVQLIGFGSFGTGERAARTG RNPQTGETIEIAAAKTVKFTAGKGFKDAVNQA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcaggaactgatcgacgccgtggcgtcggagtcgggtacaagcaaggtcgcg gcagaagagaccatcaatgccgtgtttgagacgatttcgaaagcagtggctgccggtgac gccgttcagctgatcggcttcggatcgttcgggaccggcgagcgggccgcacgaacgggt cgaaatccgcagaccggtgagacgatcgagattgcggcagccaagaccgtcaaattcacg gccggcaagggtttcaaagacgccgtcaaccaagcgtga

DBGET integrated database retrieval system