Blautia pseudococcoides: A4V09_03510 Help Entry A4V09_03510       CDS       T04458                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism byl  Blautia pseudococcoides Pathway byl01100   Metabolic pathways byl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:byl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A4V09_03510    00074 Mycolic acid biosynthesis     A4V09_03510   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A4V09_03510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ANU74906 UniProt:  A0A1C7I5M0 LinkDB All DBs Position 776595..776828 Genome browser AA seq 77 aa AA seqDB search MLEKMREIIAEQLNCEESEINPETNFKDDLGADSLDLFELVMALEDEYSVEIPAEELQEL TTVGAVMEYLKNKGVEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgttagaaaaaatgagagaaatcattgcagagcagttaaattgtgaagaaagcgaaatc aatccggaaacaaatttcaaggatgatttaggagcagattctctggatttattcgaactg gttatggcacttgaggatgagtattccgtagaaattcccgctgaggaattacaggaactg acaactgtgggcgctgttatggagtatctgaaaaataagggcgttgaagaataa

DBGET integrated database retrieval system