Bipolaris zeicola: COCCADRAFT_33177 Help Entry COCCADRAFT_33177  CDS       T03110                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism bze  Bipolaris zeicola Pathway bze03050   Proteasome bze03440   Homologous recombination Brite KEGG Orthology (KO) [BR:bze00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     COCCADRAFT_33177   09124 Replication and repair    03440 Homologous recombination     COCCADRAFT_33177  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bze03019]     COCCADRAFT_33177    04131 Membrane trafficking [BR:bze04131]     COCCADRAFT_33177    03051 Proteasome [BR:bze03051]     COCCADRAFT_33177    03400 DNA repair and recombination proteins [BR:bze03400]     COCCADRAFT_33177 Messenger RNA biogenesis [BR:bze03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      COCCADRAFT_33177 Membrane trafficking [BR:bze04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     COCCADRAFT_33177 Proteasome [BR:bze03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      COCCADRAFT_33177 DNA repair and recombination proteins [BR:bze03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      COCCADRAFT_33177 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  19147433 NCBI-ProteinID:  XP_007708067 JGI:  33177 UniProt:  W6Z1T2 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MSGSAQGSNDMKKAVTNDSKNGEQPLAPEKKPATQLEEDDEFEDFPVEGPDWTEEETQIP NGNTHLWEESWDDDDTNDDFAVQLREELKKLGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtccggctcagcgcaaggaagcaacgatatgaagaaggccgtgaccaacgactcgaag aacggcgagcaaccgctggcaccggagaagaagcctgcgacacaactcgaggaggatgac gagtttgaggactttcccgtcgaagggccagactggacagaagaggagacacagatcccc aacggcaacacacacctgtgggaggagagctgggatgatgatgacacgaacgatgacttt gccgtgcagctgagggaggagctgaagaagctgggcaaatga

DBGET integrated database retrieval system