Bipolaris zeicola: COCCADRAFT_4431 Help Entry COCCADRAFT_4431   CDS       T03110                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism bze  Bipolaris zeicola Pathway bze03060   Protein export bze04141   Protein processing in endoplasmic reticulum bze04145   Phagosome Brite KEGG Orthology (KO) [BR:bze00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     COCCADRAFT_4431    04141 Protein processing in endoplasmic reticulum     COCCADRAFT_4431  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     COCCADRAFT_4431  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bze04131]     COCCADRAFT_4431   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:bze02044]     COCCADRAFT_4431 Membrane trafficking [BR:bze04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     COCCADRAFT_4431 Secretion system [BR:bze02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    COCCADRAFT_4431 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  19149775 NCBI-ProteinID:  XP_007711511 JGI:  4431 UniProt:  W6Y9L1 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MENIKEFADMPAEFLKEGTLFMNRCTKPDKKEFIRISQAVGIGFLIMGVIGYVVKLIHIP VNNILVGGS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaaaacatcaaggagtttgccgatatgcccgctgagttcctcaaggagggtactctc ttcatgaaccgctgcaccaagcccgacaagaaggagttcatcaggatatcgcaagccgtc ggaatcggtttcctgatcatgggcgtcattggctacgtcgtcaagcttatccacattccc gtcaacaacatcctcgtcggcggctcataa

DBGET integrated database retrieval system