Bacteroides zoogleoformans: C4H11_01975 Help Entry C4H11_01975       CDS       T05371                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bzg  Bacteroides zoogleoformans Brite KEGG Orthology (KO) [BR:bzg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bzg03032]     C4H11_01975    03036 Chromosome and associated proteins [BR:bzg03036]     C4H11_01975    03400 DNA repair and recombination proteins [BR:bzg03400]     C4H11_01975 DNA replication proteins [BR:bzg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C4H11_01975 Chromosome and associated proteins [BR:bzg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C4H11_01975 DNA repair and recombination proteins [BR:bzg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C4H11_01975 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_1 HU-HIG MS_channel_2nd DUF5915 Motif Other DBs NCBI-ProteinID:  AVM51887 UniProt:  A0ABM6T5J6 LinkDB All DBs Position complement(455480..455752) Genome browser AA seq 90 aa AA seqDB search MNNKEFTSELSRRLGYTLKDTSDLIASLLSNMTRQFEAGNVVSIQTFGTFEVKKKAERIS VNPNTKQRMLVPPKLVLTYKPSALLKEKFK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaataacaaagagtttacttccgaattatcacgcagattggggtatactttgaaggat acttctgatttgattgcttcattgctgtcgaatatgacaaggcagtttgaggccggaaat gttgtttccatacagacattcggaacattcgaggtaaagaagaaagcggagcgcatatct gtaaatccgaataccaaacagcgtatgctggttcctcctaaattagtgttgacctataaa ccgagtgcgttgctaaaagaaaagtttaaatag

DBGET integrated database retrieval system