Bacteroides zoogleoformans: C4H11_11170 Help Entry C4H11_11170       CDS       T05371                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bzg  Bacteroides zoogleoformans Pathway bzg00020   Citrate cycle (TCA cycle) bzg00720   Other carbon fixation pathways bzg01100   Metabolic pathways bzg01110   Biosynthesis of secondary metabolites bzg01120   Microbial metabolism in diverse environments bzg01200   Carbon metabolism bzg01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bzg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     C4H11_11170   09102 Energy metabolism    00720 Other carbon fixation pathways     C4H11_11170 Enzymes [BR:bzg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      C4H11_11170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_2 Fer4_6 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_15 Fer4_8 Fer4_22 Fer4_20 Fer4_13 Fer4_17 DUF5651 Fer4_3 Motif Other DBs NCBI-ProteinID:  AVM53416 LinkDB All DBs Position complement(2659895..2660122) Genome browser AA seq 75 aa AA seqDB search MAKMKGAIVVDTERCKGCNLCVAACPLNVLALTKEVNVKGYNYAHQILEDTCNGCTSCAT VCPDGCISVYKVKLA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaagatgaaaggagcaatcgtggtggacacggaacgttgcaaaggctgcaacctg tgtgtggcagcttgtccgctgaatgtgttggccctcaccaaagaggtgaatgtgaaaggg tataactatgcccatcagatattggaggatacgtgcaacggctgcacttcgtgcgccacg gtgtgtccggacggatgtatctccgtgtataaagtgaaattagcataa

DBGET integrated database retrieval system