Bacillus zhangzhouensis: NF868_07615 Help Entry NF868_07615       CDS       T08887                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bzh  Bacillus zhangzhouensis Pathway bzh02024   Quorum sensing bzh03018   RNA degradation Brite KEGG Orthology (KO) [BR:bzh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NF868_07615 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NF868_07615 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bzh03019]     NF868_07615 (hfq)    03036 Chromosome and associated proteins [BR:bzh03036]     NF868_07615 (hfq) Messenger RNA biogenesis [BR:bzh03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NF868_07615 (hfq) Chromosome and associated proteins [BR:bzh03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NF868_07615 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  UYO37026 LinkDB All DBs Position 1508354..1508575 Genome browser AA seq 73 aa AA seqDB search MKPINIQEQFLNQIRKDNTFVTVFLLNGFQLRGQVKGFDNFTVLLETEGKQQLIYKHAIS TFAPQKNVNLEIE NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaaaccgattaatattcaggaacagtttttgaatcagatccgcaaagacaatacattt gtcacagtattcttactgaatggctttcagcttcgcggtcaagtgaaagggtttgacaat ttcacggtgctgcttgaaacagaagggaagcagcagcttatttataaacacgccatttct acatttgcacctcaaaagaatgtaaatctagaaatagaatag

DBGET integrated database retrieval system